Size | 20µg, 100µg |
---|---|
Active Protein | |
Activity | |
Protein Construction | |
Sequence | MWCASPVAVVAFCAGLLVSHPVLTQGQEAGGRPGADCEVCKEFLNRFYKSLIDRGVNFSLDTIEKELISFCLDTKGKENRLCYYLGATKDAATKILSEVTRPMSVHMPAMKICEKLKKLDSQICELKYEKTLDLASVDLRKMRVAELKQILHSWGEECRACAEKTDYVNLIQELAPKYAATHPKTEL |
Fusion Tag | N-His |
Accession | Q49AH0 |
Species | Human |
Expressed Host | E.coli |
Shipping | This product is provided as lyophilized powder which is shipped with ice packs. |
Purity | >98% as determined by SDS-PAGE. |
Endotoxin | <0.1 EU per 1 μg of the protein by the LAL method. |
Stability and Storage | Generally, lyophilized proteins are stable for up to 12 months when stored at -20 to -80℃. Reconstituted protein solution can be stored at 4-8℃ for 2-7 days. Aliquots of reconstituted samples are stable at < -20℃ for 3 months. |
Mol Mass | 21.79 kDa |
AP Mol Mass | |
Formulation | Lyophilized from sterile PBS, pH 8.0 |
Research Areas | |
Reconstitution | Please refer to the printed manual for detailed information. |
Related Product
Related products
-
Protein
Recombinant ZIKV (strain Zika SPH2016) Stem/anchor domain of flavivirus envelope glycoprotein E protein (Fc Tag)
£540.00 – £855.00 excluding VAT