Size | 20µg, 100µg |
---|---|
Active Protein | Active protein |
Activity | Measure by its ability to induce proliferation in HUVEC cells. The ED50 for this effect is <6 ng/mL. |
Protein Construction | |
Sequence | MAARRSQRRRGRRGEPGTALLVPLALGLGLALACLGLLLAVVSLGSRASLSAQEPAQEELVAEEDQDPSELNPQTEESQDPAPFLNRLVRPRRSAPKGRKTRARRAIAAHYEVHPRPGQDGAQAGVDGTVSGWEEARINSSSPLRYNRQIGEFIVTRAGLYYLYCQVHFDEGKAVYLKLDLLVDGVLALRCLEEFSATAASSLGPQLRLCQVSGLLALRPGSSLRIRTLPWAHLKAAPFLTYFGLFQVH |
Fusion Tag | N-His |
Accession | O43508 |
Species | Human |
Expressed Host | E.coli |
Shipping | This product is provided as lyophilized powder which is shipped with ice packs. |
Purity | >98% as determined by SDS-PAGE. |
Endotoxin | <0.1 EU per 1 μg of the protein by the LAL method. |
Stability and Storage | Generally, lyophilized proteins are stable for up to 12 months when stored at -20 to -80℃. Reconstituted protein solution can be stored at 4-8℃ for 2-7 days. Aliquots of reconstituted samples are stable at < -20℃ for 3 months. |
Mol Mass | 28.04 kDa |
AP Mol Mass | |
Formulation | Lyophilized from sterile PBS, pH 8.0 |
Research Areas | |
Reconstitution | Please refer to the printed manual for detailed information. |
Recombinant Human TWEAK protein(N-His)(active)
£200.00 – £584.00 excluding VAT