Fagus Antibody Services

Recombinant Mouse IL-11 protein(N-His)(active)

£200.00£584.00 excluding VAT

SKU FAS-041478-P Category Tags ,
Size

20µg, 100µg

Active Protein

Active protein

Activity

Measure by its ability to induce T11 cells proliferation. The ED50 for this effect is 2 x 106 IU/mg.

Protein Construction
Sequence

MNCVCRLVLVVLSLWPDRVVAPGPPAGSPRVSSDPRADLDSAVLLTRSLLADTRQLAAQMRDKFPADGDHSLDSLPTLAMSAGTLGSLQLPGVLTRLRVDLMSYLRHVQWLRRAGGPSLKTLEPELGALQARLERLLRRLQLLMSRLALPQAAPDQPVIPLGPPASAWGSIRAAHAILGGLHLTLDWAVRGLLLLKTRL

Fusion Tag

N-His

Accession

P47873

Species

Mouse

Expressed Host

E.coli

Shipping

This product is provided as lyophilized powder which is shipped with ice packs.

Purity

>98% as determined by SDS-PAGE.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Stability and Storage

Generally, lyophilized proteins are stable for up to 12 months when stored at -20 to -80℃. Reconstituted protein solution can be stored at 4-8℃ for 2-7 days. Aliquots of reconstituted samples are stable at < -20℃ for 3 months.

Mol Mass

22.35 kDa

AP Mol Mass
Formulation

Lyophilized from sterile PBS, pH 8.0

Research Areas
Reconstitution

Please refer to the printed manual for detailed information.

Related Product