Recombinant Mouse IL-17F protein(N-His)(active)

Size	20µg, 100µg
Active Protein	Active protein
Activity	Measure by its ability to induce IL-6 secretion in 3T3 cells. The ED50 for this effect is <100 ng/mL.
Protein Construction
Sequence	MKCTRETAMVKSLLLLMLGLAILREVAARKNPKAGVPALQKAGNCPPLEDNTVRVDIRIFNQNQGISVPREFQNRSSSPWDYNITRDPHRFPSEIAEAQCRHSGCINAQGQEDSTMNSVAIQQEILVLRREPQGCSNSFRLEKMLLKVGCTCVKPIVHQAA
Fusion Tag	N-His
Accession	Q7TNI7
Species	Mouse
Expressed Host	E.coli
Shipping	This product is provided as lyophilized powder which is shipped with ice packs.
Purity	>98% as determined by SDS-PAGE.
Endotoxin	<0.1 EU per 1 μg of the protein by the LAL method.
Stability and Storage	Generally, lyophilized proteins are stable for up to 12 months when stored at -20 to -80℃. Reconstituted protein solution can be stored at 4-8℃ for 2-7 days. Aliquots of reconstituted samples are stable at < -20℃ for 3 months.
Mol Mass	18.77 kDa
AP Mol Mass
Formulation	Lyophilized from a solution containing 20 mM sodium citrate, pH 4.5.
Research Areas
Reconstitution	Please refer to the printed manual for detailed information.

Related Product