Fagus Antibody Services

Recombinant Swine BMP-4 protein(N-His)

£200.00£584.00 excluding VAT

SKU FAS-000011-P Category
Size

20µg, 100µg

Active Protein
Activity
Protein Construction
Sequence

MIPGNRMLMVVLLCQVLLGGASHASLIPETGKKKVAEIQGHAGGRRSGQSHELLRDFEATLLQMFGLRRRPQPSKSAVIPDYMRDLYRLQSGEEEEEEQTHSVGLEYPERPASRANTVRSFHHEEHLENIPGTSENSAFRFLFNLSSIPENEVISSAELRLFREQVDQGPDWEQGFHRINIYEVMKPPPEVVPGHLITRLLDTRLVHHNVTRWETFDVSPAVLRWTREKQPNYGLAIEVTHLHQTRTHQGQHVRISRSLPQGSGDWAQLRPLLVTFGHDGRGHALTRRRRAKRSPKHHPQRARKKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTNHAIVQTLVNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQEMVVEGCGCR

Fusion Tag

N-His

Accession

A7LJT9

Species

Sus scrofa (pig)

Expressed Host

E.coli

Shipping

This product is provided as lyophilized powder which is shipped with ice packs.

Purity

>98% as determined by SDS-PAGE.

Endotoxin

Please contact us for more information.

Stability and Storage

Generally, lyophilized proteins are stable for up to 12 months when stored at -20 to -80℃. Reconstituted protein solution can be stored at 4-8℃ for 2-7 days. Aliquots of reconstituted samples are stable at < -20℃ for 3 months.

Mol Mass

47.51 kDa

AP Mol Mass
Formulation

Lyophilized from a solution containing 20 mM sodium citrate, 0.2 M NaCl, pH 3.5.

Research Areas
Reconstitution

Please refer to the printed manual for detailed information.

Related Product