Recombinant Swine CXCL9 protein(N-His)

Size	20µg, 100µg
Active Protein
Activity
Protein Construction
Sequence	MKKSSVALLLGIIFLTLIGVQGTLLMRNGRCSCINTSQRMIHLKSLRDLKQFAPSPSCEKMEVIATMKNGDQTCLNPDSPDVKKLIKEWEKQVSLKKKQKKGKKHPKTKKVRKVKKSQRPDQKKMT
Fusion Tag	N-His
Accession	A0A4X1SX95
Species	Sus scrofa (pig)
Expressed Host	E.coli
Shipping	This product is provided as lyophilized powder which is shipped with ice packs.
Purity	>98% as determined by SDS-PAGE.
Endotoxin	Please contact us for more information.
Stability and Storage	Generally, lyophilized proteins are stable for up to 12 months when stored at -20 to -80℃. Reconstituted protein solution can be stored at 4-8℃ for 2-7 days. Aliquots of reconstituted samples are stable at < -20℃ for 3 months.
Mol Mass	15.19 kDa
AP Mol Mass
Formulation	Lyophilized from sterile PBS, pH 7.4
Research Areas
Reconstitution	Please refer to the printed manual for detailed information.

Related Product